CiteULike: durduran's Balzer:JR [1 article]

Search all the public and authenticated articles in CiteULike.
Enter a search phrase. You can also specify

a CiteULike article id (123456),

a DOI (doi:10.1234/12345678)

or a PubMed Id (pmid:12345678).

Click Help for advanced usage.

durduran's tags

All tags in durduran's library

Filter:

Privacy Statement | Terms & Conditions

CiteULike organises scholarly (or academic) papers or literature and provides bibliographic (which means it makes bibliographies) for universities and higher education establishments. It helps undergraduates and postgraduates. People studying for PhDs or in postdoctoral (postdoc) positions. The service is similar in scope to EndNote or RefWorks or any other reference manager like BibTeX, but it is a social bookmarking service for scientists and humanities researchers.

eylembibtex	1110
nirs	61
bibtex-import	51
drbbibtex-import	50
cbf	39
stroke	30
near-infrared	20
dcs	18
ischemia	16
congenitalheartdefect	15
chd	15
strokepublicity	14
ischemicstroke	14
upenn	14
durduran	14
neonate	14
news_tdresearch	14
hypercapnia	13
neonatal	10
review	9
humans	9
adult	8
dot	8
file-import-08-06-12	8
statistical	7
trs	7
models	7
breast	6
aged	6
nearinfrared	6
icg	6
tcd	6
flow	5
middle	5
timesresolved	5
functional	5
congenitalheart	5
brain	5
mri	5
imaging	5
light	5
neoplasms	5
xenonct	4
montecarlo	4
of	4
diffuseoptics	4
indocyanine	4
female	4
cmro2	4
blood	4
green	4
cerebralbloodflow	4
factors	4
autoregulation	4
time-domain-analysis	4
mammography	4
carlo	3
results	3
bypass	3
kurth	3
spectrophotometry	3
diffuse	3
risk	3
fluorescein	3
nearinfraredspectroscopy	3
angiography	3
children	3
computer-assisted	3
bold	3
piglet	3
monitoring	3
functionalimaging	3
xenoncbfeffect	3
congenital	3
fluorescence	3
biophysics	3
infrared	3
animals	3
laserdoppler	3
timedomain	3
neurology	3
opticalmammography	3
reproducibility	3
monte	3
cerebral	3
allages	3
diffusion	3
co2	3
component	2
speckle	2
absorption	2
degeneration	2
classic	2
algorithms	2
image	2
agents	2
transport	2
evokedpotentials	2
cognitive	2
rat	2
laser	2
brittonchance	2
continuum	2
stochastic	2
interpretation	2
processes	2
time	2
statistics	2
neovascularization	2
artery	2
choroid	2
mathematics	2
male	2
ois	2
coloring	2
muscles	2
sep	2
okada	2
retinal	2
toexport	2
curve	2
modeling	2
tumor	2
photons	2
principal	2
file-import-08-12-08	2
confidence	2
pediatric	2
macular	2
pathologic	2
oxygenation	2
fundus	2
neonates	2
optics	2
frequencydomain	2
analysis	2
doppler	2
tomography	2
molecularimaging	2
fmri	2
surgery	2
oculi	2
laserspeckle	2
motor	2
classicreference	2
method	2
bloodflow	2
trauma	2
and	2
transillumination	2
intervals	2
chancewilson	1
europe	1
lifetime	1
mammary	1
akaikacriteria	1
charite	1
jbo	1
boas	1
healing	1
diagnosis	1
file-import-08-09-30	1
language	1
regulation	1
warfare	1
stroketreatment	1
diagnostic	1
studies	1
follow-up	1
frequency-domain-analysis	1
hob	1
caffeine	1
optical-tomography	1
pigment	1
baby	1
hemodynamics	1
history	1
phasecancellation	1
pogue	1
scattering	1
metabolism	1
illustion	1
sliced	1
culver	1
european	1
retinitis	1
diffusive	1
cancer	1
timeresolved	1
newborn	1
ana	1
rupture	1
pigmented	1
biological	1
headofbedposition	1
mu_s	1
cariopulmorybypass	1
lme	1
peace	1
adolescent	1
rats	1
invos	1
clinicalmeasurement	1
dopplerultrasound	1
assessment	1
thresholds	1
humanity	1
cardiopulmonary	1
f344	1
supportvector	1
hypercania	1
retinopathy	1
seizure	1
europeanstrokeinitiative	1
index	1
photonefficiency	1
kirkpatrick	1
image-reconstruction	1
cyanine	1
wound	1
time-domainanalysis	1
contrast	1
carbondioxide	1
spectroscopy	1
theoretical	1
specificity	1
file-import-08-09-02	1
twolayer	1
bioluminescence	1
europeanunion	1
hemangioma	1
detection	1
diabetic	1
cardiopulmanory	1
finite-element-analysis	1
society	1
media	1
melanoma	1
depthpenetration	1
fast	1
circulation	1
pad	1
enhancement	1
pilot	1
carotidocclusivedisease	1
primate	1
diseases	1
clearance	1
80	1
sourceterm	1
disease	1
visual	1
vasoreactivity	1
low-scattering	1
pigmentosa	1
chance	1
franceschini	1
brainfunction	1
rtpa	1
radiation	1
triiodobenzoic	1
ldf	1
tbi	1
theory	1
body	1
correlationfunctions	1
age	1
peripheralarterialdisease	1
metabolic	1
epithelium	1
recovery	1
tutorial	1
hypercapniaclassicalrefreviewgetwholeissue	1
mouse	1
regional	1
flowmetry	1
coagulation	1
broadband	1
generalinterest	1
verbalfluency	1
classification	1
rays	1
phantoms	1
velocity	1
neoplasia	1
finitelements	1
forepaw	1
lasers	1
heterodyne	1
eye	1
villringer	1
development	1
r-project	1
treatment	1
mousemodel	1
hypoexima	1
mass	1
trancranialdoppler	1
nlme	1
medical-image-processing	1
file-import-08-08-21	1
nonwork	1
whitelight	1
projects	1
pulseoximetry	1
inbred	1
hlhs	1
cultureconflict	1
brownianmotion	1
correlator	1
ey	1
infant	1
tribal	1
turbidmedia	1
neurovascularcoupling	1
neuroprotective	1
mu_a	1
liebert	1
locomotor	1
pharmacologicalintervention	1
nevus	1
huabei	1
wabnitz	1
uveal	1
statisticsonchd	1
cubeddu	1
fnirs	1
optical	1
intraoperative	1
hillman	1
diffusecorrelation	1
8532764	1
occlusive	1
properties	1
ultrasonography	1
art	1
dws	1
carotid	1
occulusion	1
gratton	1
pco2	1
hypothermia	1
adenocarcinoma	1
genocide	1
vision	1
strokeguidelines	1
standard	1
mridot	1
transcranialdoppler	1
photon	1
isoflurane	1
1631197	1
recanalization	1
nearinfared	1
hypoxia	1
multilayer	1
asl	1
simulation	1
over	1
detachment	1
radiographic	1
roc	1
lsf	1
indocynaninegreen	1
diffuseiontheory	1
under	1
opticalintrinsicsignals	1
spect	1
blandlatman	1
fetal	1
traumaticbraininjury	1
cbv	1
cell	1
strangulation	1
merci	1
retrospective	1
meningitis	1
functionalmapping	1
nih	1
workshop	1
epilepsy	1
lasca	1
vasilis	1
supercontinuum	1
acuity	1
sensitivity	1
logistic	1
hemorrhage	1
correlation	1
time-domain	1
rate	1
electrophysiology	1
stimulation	1
line	1
computer	1
acids	1
vein	1
area	1
lamb	1
pet	1
outcome	1

durduran's Balzer:JR [1 article] Export

durduran's tags