durduran's Chance:B [55 articles] Export

Recent papers posted to durduran's library by the author Chance:B. You can also see everyone's Chance:B.

	Sources of phase noise in homodyne and heterodyne phase modulation devices used for tissue oximetry studies [My Copy] Review of Scientific Instruments, Vol. 69, No. 8. (1998), pp. 3042-3054. by N. Ramanujam, C. Du, H. Y. Ma, B. Chance posted to eylembibtex by durduran on 2009-01-09 19:03:49 as along with 1 person ebuckle2
	$My PDF o’leary_92_refraction.pdf$ Refraction of diffuse photon density waves [My Copy] Physical Review Letters, Vol. 69, No. 18. (2 November 1992), 2658. by M. A. O’leary, D. A. Boas, B. Chance, A. G. Yodh posted to eylembibtex by durduran on 2009-01-08 22:42:05 as
	Spectroscopy and Imaging with Diffusing Light [My Copy] Physics Today, Vol. 48, No. 3. (1995), pp. 34-40. by Arjun Yodh, Britton Chance posted to eylembibtex by durduran on 2009-01-08 22:37:36 as along with 1 person kdouglass
	Experimental images of heterogeneous turbid media by frequency-domain diffusing-photon tomography [My Copy] Opt. Lett., Vol. 20, No. 5. (1 March 1995), pp. 426-428. by M. A. O?leary, D. A. Boas, B. Chance, A. G. Yodh posted to eylembibtex by durduran on 2009-01-08 22:21:04 as
	Detection and characterization of optical inhomogeneities with diffuse photon density waves: a signal-to-noise analysis [My Copy] Appl. Opt., Vol. 36, No. 1. (1 January 1997), pp. 75-92. by D. A. Boas, M. A. O?leary, B. Chance, A. G. Yodh posted to eylembibtex by durduran on 2009-01-08 21:06:55 as
	Scattering of diffuse photon density waves by spherical inhomogeneities within turbid media: analytic solution and applications. [My Copy] Proc Natl Acad Sci U S A, Vol. 91, No. 11. (24 May 1994), pp. 4887-4891. by D. A. Boas, M. A. O'Leary, B. Chance, A. G. Yodh posted to eylembibtex by durduran on 2009-01-08 20:32:08 as along with 1 person eyliu
	Oximetry based on diffuse photon density wave differentials [My Copy] Medical Physics, Vol. 27, No. 2. (2000), pp. 410-421. by Vasilis Ntziachristos, Matthias Kohl, Honyan Ma, Britton Chance posted to eylembibtex by durduran on 2009-01-02 22:29:13 as
	Photon migration in the presence of a single defect: a perturbation analysis [My Copy] Appl. Opt., Vol. 34, No. 19. (1 July 1995), pp. 3826-3837. by Shechao Feng, Fan-An Zeng, Britton Chance posted to eylembibtex by durduran on 2009-01-02 21:50:01 as
	Modeling photon transport in transabdominal fetal oximetry [My Copy] Journal of Biomedical Optics, Vol. 5, No. 3. (2000), pp. 277-282. by Steven L. Jacques, Nirmala Ramanujam, Gargi Vishnoi, Regine Choe, Britton Chance posted to eylembibtex by durduran on 2008-12-18 18:07:19 as
	Photon migration through fetal head in utero using continuous wave, near-infrared spectroscopy: development and evaluation of experimental and numerical models [My Copy] Journal of Biomedical Optics, Vol. 5, No. 2. (2000), pp. 163-172. by Gargi Vishnoi, Andreas H. Hielscher, Nirmala Ramanujam, Britton Chance posted to eylembibtex by durduran on 2008-12-18 17:08:10 as
	Transabdominal near infrared oximetry of hypoxic stress in fetal sheep brain in utero. [My Copy] Proceedings of the National Academy of Sciences of the United States of America, Vol. 100, No. 22. (28 October 2003), pp. 12950-12954. by R. Choe, T. Durduran, G. Yu, et al.M. J. Nijland, B. Chance, A. G. Yodh, N. Ramanujam posted to eylembibtex by durduran on 2008-12-18 16:24:43 as
	Results of a 95-subject human clinical trial for the diagnosis of peripheral vascular disease using a near-infrared frequency domain hemoglobin spectrometer [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 300-316. by Don J. Wallace, Brent Michener, Devasmita Choudhury, et al.Moshe Levi, Padraic Fennelly, Dennis M. Hueber, Beniamino B. Barbieri edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-12-16 20:54:38 as
	New optical probe designs for absolute (self-calibrating) NIR tissue hemoglobin measurements [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 618-631. by Dennis M. Hueber, Sergio Fantini, Albert E. Cerussi, Beniamino B. Barbieri edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-12-16 20:11:10 as
	Near-infrared spectroscopy and the tilting table protocol: a novel method to study the blood flow and the oxygen consumption in tissues [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 685-692. by Claudia Casavola, Lelia A. Paunescu, Maria A. Franceschini, et al.Sergio Fantini, Lew Winter, Jin Kim, Debra Wood, Enrico Gratton edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-12-16 20:03:33 as
	A dynamic phantom brain model for near-infrared spectroscopy. [My Copy] Physics in medicine and biology, Vol. 40, No. 12. (December 1995), pp. 2079-2092. by C. D. Kurth, H. Liu, W. S. Thayer, B. Chance posted to eylembibtex by durduran on 2008-12-15 21:00:59 as
	Predicting Melanoma Metastatic Potential By Optical And Magnetic Resonance Imaging [My Copy] Oxygen Transport to Tissue XXVIII (2008), pp. 67-78. by Lin Li, Rong Zhou, Tuoxiu Zhong, et al.Lily Moon, Eun Kim, Qiao Hui, Stephen Pickup, Mary Hendrix, Dennis Leeper, Britton Chance, Jerry Glickson posted to eylembibtex by durduran on 2008-12-05 20:13:22 as
	Optical Method [My Copy] Annual Review of Biophysics and Biophysical Chemistry, Vol. 20, No. 1. (1991), pp. 1-30. by B. Chance posted to eylembibtex by durduran on 2008-12-01 18:46:56 as along with 1 person bettinagu
	Breast tumor images of a hemodynamic information using a contrast agent with back projection and FFT enhancement [My Copy] Advances in Optical Imaging and Photon Migration, Vol. 21 (March 1998), ATuD8. by S. Nioka, Sb, X. Li, Y. Yang, B. Chance, Fujimoto posted to eylembibtex by durduran on 2008-11-19 18:13:43 as
	Breast tumor detection using continuous wave light source [My Copy] Optical Tomography, Photon Migration, and Spectroscopy of Tissue and Model Media: Theory, Human Studies, and Instrumentation, Vol. 2389, No. 1. (1995), pp. 809-817. by Shiyin Zhao, Maureen A. O'Leary, Shoko Nioka, Britton Chance edited by Britton Chance, Robert R. Alfano posted to eylembibtex by durduran on 2008-11-19 18:06:25 as
	Optical imaging of breast tumor by means of continuous waves. [My Copy] Advances in experimental medicine and biology, Vol. 411 (1997), pp. 227-232. by S. Nioka, Y. Yung, M. Shnall, et al.S. Zhao, S. Orel, C. Xie, B. Chance, L. Solin posted to eylembibtex by durduran on 2008-11-19 17:57:32 as
	Multiport time-domain laser mammography: results on solid phantoms and volunteers [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 548-555. by Yves Painchaud, Alain Mailloux, Eric R. Harvey, et al.Sonia Verreault, Julie Frechette, Caroline Gilbert, Marcia L. Vernon, Pierre Beaudry edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-11-18 23:50:23 as
	Near-Infrared Images Using Continuous, Phase-Modulated, and Pulsed Light with Quantitation of Blood and Blood Oxygenation<sup>a</sup> [My Copy] Annals of the New York Academy of Sciences, Vol. 838, No. ADVANCES IN OPTICAL BIOPSY AND OPTICAL MAMMOGRAPHY. (1998), pp. 29-45. by Britton Chance posted to eylembibtex by durduran on 2008-11-18 23:43:54 as
	Near-infrared images using continuous, phase-modulated, and pulsed light with quantitation of blood and blood oxygenation. [My Copy] Annals of the New York Academy of Sciences, Vol. 838 (9 February 1998), pp. 29-45. by B. Chance posted to eylembibtex by durduran on 2008-11-18 23:09:13 as
	Near-infrared absorption and scattering spectra of tissues in vivo [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 526-531. by Maria A. Franceschini, Enrico Gratton, Dennis M. Hueber, Sergio Fantini edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-11-18 20:41:44 as
	Quantitative measurement of optical parameters in normal breasts using time-resolved spectroscopy: in vivo results of 30 Japanese women [My Copy] Journal of Biomedical Optics, Vol. 1 (July 1996), pp. 330-334. by K. Suzuki, Y. Yamashita, K. Ohta, M. Kaneko, M. Yoshida, B. Chance posted to eylembibtex by durduran on 2008-11-14 19:13:08 as
	Determination of optical properties and blood oxygenation in tissue using continuous NIR light. [My Copy] Physics in medicine and biology, Vol. 40, No. 11. (November 1995), pp. 1983-1993. by H. Liu, D. A. Boas, Y. Zhang, A. G. Yodh, B. Chance posted to eylembibtex by durduran on 2008-11-11 18:38:16 as
	Phase measurement of light absorption and scatter in human tissue [My Copy] Review of Scientific Instruments, Vol. 69, No. 10. (1998), pp. 3457-3481. by B. Chance, M. Cope, E. Gratton, N. Ramanujam, B. Tromberg posted to eylembibtex by durduran on 2008-11-11 17:39:19 as
	Differential diffuse optical tomography [My Copy] Opt. Express, Vol. 5, No. 10. (November 1999), pp. 230-242. by Vasilis Ntziachristos, Britton Chance, Arjun Yodh posted to eylembibtex by durduran on 2008-11-07 20:20:41 as
	Time-resolved photon emission from layered turbid media [My Copy] Appl. Opt., Vol. 35, No. 4. (1 February 1996), pp. 719-728. by Andreas H. Hielscher, Hanli Liu, Britton Chance, Frank K. Tittel, Steven L. Jacques posted to eylembibtex by durduran on 2008-11-07 19:14:09 as
	Projection access order in algebraic reconstruction technique for diffuse optical tomography. [My Copy] Physics in medicine and biology, Vol. 47, No. 1. (7 January 2002) by X. Intes, V. Ntziachristos, J. P. Culver, A. Yodh, B. Chance posted to eylembibtex by durduran on 2008-11-07 16:24:28 as
	Multi-frequency diffuse optical tomography [My Copy] Journal of Modern Optics, Vol. 52, No. 15. (15 October 2005), pp. 2139-2159. by Xavier Intes, Britton Chance posted to eylembibtex by durduran on 2008-11-07 16:10:53 as
	Algorithms for 3D localization and imaging using near-field diffraction tomography with diffuse light [My Copy] Opt. Express, Vol. 4, No. 8. (12 April 1999), pp. 247-262. by Turgut Durduran, J. Culver, M. Holboke, et al.X. Li, Leonid Zubkov, Britton Chance, Deva Pattanayak, Arjun Yodh posted to eylembibtex by durduran on 2008-11-04 23:15:15 as
	Repetitive patterns of metabolic changes during cortical spreading depression of the awake rat. [My Copy] Brain research, Vol. 65, No. 3. (18 January 1974), pp. 529-533. by A. Mayevsky, B. Chance posted to eylembibtex by durduran on 2008-10-14 19:52:26 as
	Pyropheophorbide 2-Deoxyglucosamide: A New Photosensitizer Targeting Glucose Transporters [My Copy] Bioconjugate Chem., Vol. 14, No. 4. (16 July 2003), pp. 709-714. by M. Zhang, Z. Zhang, D. Blessington, et al.H. Li, T. M. Busch, V. Madrak, J. Miles, B. Chance, J. D. Glickson, G. Zheng posted to eylembibtex by durduran on 2008-10-02 22:22:33 as
	NADH brain surface scanning and 3-D computer display [My Copy] Brain Research, Vol. 76, No. 3. (23 August 1974), pp. 473-479. by B. Stuart, B. Chance posted to eylembibtex by durduran on 2008-10-02 21:41:55 as
	NADH brain surface scanning and 3-D computer display. [My Copy] Brain research, Vol. 76, No. 3. (23 August 1974), pp. 473-479. by B. H. Stuart, B. Chance posted to eylembibtex by durduran on 2008-10-02 21:33:49 as
	Non-invasive and quantitative near-infrared haemoglobin spectrometry in the piglet brain during hypoxic stress, using a frequency-domain multidistance instrument. [My Copy] Physics in medicine and biology, Vol. 46, No. 1. (January 2001), pp. 41-62. by D. M. Hueber, M. A. Franceschini, H. Y. Ma, et al.Q. Zhang, J. R. Ballesteros, S. Fantini, D. Wallace, V. Ntziachristos, B. Chance posted to eylembibtex by durduran on 2008-10-02 18:27:01 as
	Modeling of a focused beam in a semi-infinite highly scattering medium [My Copy] Optical Tomography and Spectroscopy of Tissue III, Vol. 3597, No. 1. (1999), pp. 118-129. by Andreas Tycho edited by Britton Chance, Robert R. Alfano, Bruce J. Tromberg posted to eylembibtex by durduran on 2008-09-23 21:26:30 as
	Effects due to geometry and boundary conditions in multiple light scattering [My Copy] Physical Review E, Vol. 48, No. 3. (1993), 2212. by C. P. Gonatas, M. Miwa, M. Ishii, J. Schotland, B. Chance, J. S. Leigh posted to eylembibtex by durduran on 2008-09-18 23:51:55 as
	Near-infrared monitoring of the cerebral circulation [My Copy] Journal of Clinical Monitoring and Computing, Vol. 9, No. 3. (11 October 1992), pp. 163-170. by Dean C. Kurth, J. M. Steven, D. Benaron, B. Chance posted to cerebral chance kurth nearinfrared nirs piglet review by durduran on 2008-09-12 18:59:11 as
	Time resolved reflectance and transmittance for the noninvasive measurement of tissue optical properties [My Copy] Appl. Opt., Vol. 28, No. 12. (15 June 1989), 2331. by Michael S. Patterson, B. Chance, B. C. Wilson posted to brittonchance chancewilson classic nearinfrared nirs timesresolved trs by durduran on 2008-08-25 18:44:21 as along with 3 people kdouglass physicist ebuckle2
	MRI-guided diffuse optical spectroscopy of malignant and benign breast lesions. [My Copy] Neoplasia (New York, N.Y.), Vol. 4, No. 4. (g 2002), pp. 347-354. by V. Ntziachristos, A. G. Yodh, M. D. Schnall, B. Chance posted to dot mri mridot neoplasia nirs opticalmammography vasilis by durduran on 2008-08-25 18:43:39 as along with 2 people YvesDeDeene ebuckle2
	A novel method for fast imaging of brainfunction, non-invasively, with light [My Copy] Opt. Express, Vol. 2, No. 10. (11 May 1998), pp. 411-423. by Britton Chance, Endla Anday, Shoko Nioka, et al.Shuoming Zhou, Long Hong, Katherine Worden, C. Li, T. Murray, Y. Ovetsky, D. Pidikiti, R. Thomas posted to brainfunction brittonchance nearinfared nirs phasecancellation by durduran on 2008-08-25 18:43:15 as along with 1 person ebuckle2
	Breast Cancer Detection Based on Incremental Biochemical and Physiological Properties of Breast Cancers A Six-Year, Two-Site Study1 [My Copy] Academic Radiology, Vol. 12, No. 8. (2005), pp. 925-933. by B. Chance, S. Nioka, J. Zhang, et al.E. F. Conant, E. Hwang, S. Briest, S. G. Orel, M. D. Schnall, B. J. Czerniecki posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Waveforms [My Copy] Vol. 19 (1949) by Britton Chance, Vernon Hughes, Edward F. Macnichol, David Sayre, Williams posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Phase measurement of light absorption and scatter in human tissue [My Copy] Review of Scientific Instruments, Vol. 69 (1998), pp. 3457-3481. by B. Chance, M. Cope, E. Gratton, N. Ramanujam, B. Tromberg posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Rapid and Sensitive Spectrophotometry. III. A Double Beam Apparatus [My Copy] Review of Scientific Instruments, Vol. 22 (1951) by B. Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Co-Registered Images of BReats Tumors By MRI and Optical Tomography [My Copy] No. 204600. (June 2003) by Britton Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Fast CW imager for ICG and Gd kinetics [My Copy] In Proc. SPIE Vol. 6081, 60810R (Feb. 13, 2006), Vol. 6081, No. 60810R. (2006) by David, Zhongyao Zhao, Shoko Nioka, et al.Arjun G. Yodh, Mitchell Schnall, Britton Chance, Xavier Intes edited by Dimitris posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Comparison of imaged ICG and Gd kinetics with a DOT-MRI instrument. [My Copy] In Biomedical Optics 2006 Technical Digest, No. ME11. (2006) by David Busch, Xavier Intes, Shoko Nioka, Britton Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as

Note: You may cite this page as: http://www.citeulike.org/user/durduran/author/Chance:B

Result page: 1 2 Next

eylembibtex	1110
nirs	61
bibtex-import	51
drbbibtex-import	50
cbf	39
stroke	30
near-infrared	20
dcs	18
ischemia	16
congenitalheartdefect	15
chd	15
strokepublicity	14
ischemicstroke	14
upenn	14
durduran	14
neonate	14
news_tdresearch	14
hypercapnia	13
neonatal	10
review	9
humans	9
adult	8
dot	8
file-import-08-06-12	8
statistical	7
trs	7
models	7
breast	6
aged	6
nearinfrared	6
icg	6
tcd	6
flow	5
middle	5
timesresolved	5
functional	5
congenitalheart	5
brain	5
mri	5
imaging	5
light	5
neoplasms	5
xenonct	4
montecarlo	4
of	4
diffuseoptics	4
indocyanine	4
female	4
cmro2	4
blood	4
green	4
cerebralbloodflow	4
factors	4
autoregulation	4
time-domain-analysis	4
mammography	4
carlo	3
results	3
bypass	3
kurth	3
spectrophotometry	3
diffuse	3
risk	3
fluorescein	3
nearinfraredspectroscopy	3
angiography	3
children	3
computer-assisted	3
bold	3
piglet	3
monitoring	3
functionalimaging	3
xenoncbfeffect	3
congenital	3
fluorescence	3
biophysics	3
infrared	3
animals	3
laserdoppler	3
timedomain	3
neurology	3
opticalmammography	3
reproducibility	3
monte	3
cerebral	3
allages	3
diffusion	3
co2	3
component	2
speckle	2
absorption	2
degeneration	2
classic	2
algorithms	2
image	2
agents	2
transport	2
evokedpotentials	2
cognitive	2
rat	2
laser	2
brittonchance	2
continuum	2
stochastic	2
interpretation	2
processes	2
time	2
statistics	2
neovascularization	2
artery	2
choroid	2
mathematics	2
male	2
ois	2
coloring	2
muscles	2
sep	2
okada	2
retinal	2
toexport	2
curve	2
modeling	2
tumor	2
photons	2
principal	2
file-import-08-12-08	2
confidence	2
pediatric	2
macular	2
pathologic	2
oxygenation	2
fundus	2
neonates	2
optics	2
frequencydomain	2
analysis	2
doppler	2
tomography	2
molecularimaging	2
fmri	2
surgery	2
oculi	2
laserspeckle	2
motor	2
classicreference	2
method	2
bloodflow	2
trauma	2
and	2
transillumination	2
intervals	2
chancewilson	1
europe	1
lifetime	1
mammary	1
akaikacriteria	1
charite	1
jbo	1
boas	1
healing	1
diagnosis	1
file-import-08-09-30	1
language	1
regulation	1
warfare	1
stroketreatment	1
diagnostic	1
studies	1
follow-up	1
frequency-domain-analysis	1
hob	1
caffeine	1
optical-tomography	1
pigment	1
baby	1
hemodynamics	1
history	1
phasecancellation	1
pogue	1
scattering	1
metabolism	1
illustion	1
sliced	1
culver	1
european	1
retinitis	1
diffusive	1
cancer	1
timeresolved	1
newborn	1
ana	1
rupture	1
pigmented	1
biological	1
headofbedposition	1
mu_s	1
cariopulmorybypass	1
lme	1
peace	1
adolescent	1
rats	1
invos	1
clinicalmeasurement	1
dopplerultrasound	1
assessment	1
thresholds	1
humanity	1
cardiopulmonary	1
f344	1
supportvector	1
hypercania	1
retinopathy	1
seizure	1
europeanstrokeinitiative	1
index	1
photonefficiency	1
kirkpatrick	1
image-reconstruction	1
cyanine	1
wound	1
time-domainanalysis	1
contrast	1
carbondioxide	1
spectroscopy	1
theoretical	1
specificity	1
file-import-08-09-02	1
twolayer	1
bioluminescence	1
europeanunion	1
hemangioma	1
detection	1
diabetic	1
cardiopulmanory	1
finite-element-analysis	1
society	1
media	1
melanoma	1
depthpenetration	1
fast	1
circulation	1
pad	1
enhancement	1
pilot	1
carotidocclusivedisease	1
primate	1
diseases	1
clearance	1
80	1
sourceterm	1
disease	1
visual	1
vasoreactivity	1
low-scattering	1
pigmentosa	1
chance	1
franceschini	1
brainfunction	1
rtpa	1
radiation	1
triiodobenzoic	1
ldf	1
tbi	1
theory	1
body	1
correlationfunctions	1
age	1
peripheralarterialdisease	1
metabolic	1
epithelium	1
recovery	1
tutorial	1
hypercapniaclassicalrefreviewgetwholeissue	1
mouse	1
regional	1
flowmetry	1
coagulation	1
broadband	1
generalinterest	1
verbalfluency	1
classification	1
rays	1
phantoms	1
velocity	1
neoplasia	1
finitelements	1
forepaw	1
lasers	1
heterodyne	1
eye	1
villringer	1
development	1
r-project	1
treatment	1
mousemodel	1
hypoexima	1
mass	1
trancranialdoppler	1
nlme	1
medical-image-processing	1
file-import-08-08-21	1
nonwork	1
whitelight	1
projects	1
pulseoximetry	1
inbred	1
hlhs	1
cultureconflict	1
brownianmotion	1
correlator	1
ey	1
infant	1
tribal	1
turbidmedia	1
neurovascularcoupling	1
neuroprotective	1
mu_a	1
liebert	1
locomotor	1
pharmacologicalintervention	1
nevus	1
huabei	1
wabnitz	1
uveal	1
statisticsonchd	1
cubeddu	1
fnirs	1
optical	1
intraoperative	1
hillman	1
diffusecorrelation	1
8532764	1
occlusive	1
properties	1
ultrasonography	1
art	1
dws	1
carotid	1
occulusion	1
gratton	1
pco2	1
hypothermia	1
adenocarcinoma	1
genocide	1
vision	1
strokeguidelines	1
standard	1
mridot	1
transcranialdoppler	1
photon	1
isoflurane	1
1631197	1
recanalization	1
nearinfared	1
hypoxia	1
multilayer	1
asl	1
simulation	1
over	1
detachment	1
radiographic	1
roc	1
lsf	1
indocynaninegreen	1
diffuseiontheory	1
under	1
opticalintrinsicsignals	1
spect	1
blandlatman	1
fetal	1
traumaticbraininjury	1
cbv	1
cell	1
strangulation	1
merci	1
retrospective	1
meningitis	1
functionalmapping	1
nih	1
workshop	1
epilepsy	1
lasca	1
vasilis	1
supercontinuum	1
acuity	1
sensitivity	1
logistic	1
hemorrhage	1
correlation	1
time-domain	1
rate	1
electrophysiology	1
stimulation	1
line	1
computer	1
acids	1
vein	1
area	1
lamb	1
pet	1
outcome	1

durduran's Chance:B [55 articles] Export

durduran's tags