durduran's bibtex-import [51 articles] Export

Recent papers added to durduran's library classified by the tag bibtex-import. You can also see everyone's bibtex-import.

Hide details

	Correlation of in vivo photosensitizer fluorescence and photodynamic-therapy-induced depth of necrosis in a murine tumor model [My Copy] Journal Of Biomedical Optics, Vol. 8 (2003), pp. 248-252. by R. Cheung, M. Solonenko, T. M. Busch, et al.F. Del Piero, M. E. Putt, S. M. Hahn, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	In vivo cerebrovascular measurement combining diffuse near-infrared absorption and correlation spectroscopies [My Copy] Physics In Medicine And Biology, Vol. 46 (2001), pp. 2053-2065. by C. Cheung, J. P. Culver, K. Takahashi, J. H. Greenberg, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Initial clinical experience with contrast-enhanced digital breast tomosynthesis. [My Copy] Acad Radiol, Vol. 14, No. 2. (Feb 2007), pp. 229-238. by Sara C. Chen, Ann K. Carton, Michael Albert, Emily F. Conant, Mitchell D. Schnall, Andrew D. A. Maidment posted to acids adult aged bibtex-import breast computer-assisted contrast drbbibtex-import enhancement humans image interpretation mammography media middle neoplasms neovascularization pathologic pilot projects radiographic tomography triiodobenzoic by durduran on 2008-04-08 22:43:42 as
	Breast Cancer Detection Based on Incremental Biochemical and Physiological Properties of Breast Cancers A Six-Year, Two-Site Study1 [My Copy] Academic Radiology, Vol. 12, No. 8. (2005), pp. 925-933. by B. Chance, S. Nioka, J. Zhang, et al.E. F. Conant, E. Hwang, S. Briest, S. G. Orel, M. D. Schnall, B. J. Czerniecki posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Waveforms [My Copy] Vol. 19 (1949) by Britton Chance, Vernon Hughes, Edward F. Macnichol, David Sayre, Williams posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Phase measurement of light absorption and scatter in human tissue [My Copy] Review of Scientific Instruments, Vol. 69 (1998), pp. 3457-3481. by B. Chance, M. Cope, E. Gratton, N. Ramanujam, B. Tromberg posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Rapid and Sensitive Spectrophotometry. III. A Double Beam Apparatus [My Copy] Review of Scientific Instruments, Vol. 22 (1951) by B. Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Co-Registered Images of BReats Tumors By MRI and Optical Tomography [My Copy] No. 204600. (June 2003) by Britton Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:42 as
	Sources of Absorption and Scattering Contrast for Near-Infrared Optical Mammography [My Copy] Academic Radiology, Vol. 8, No. 3. (2001), pp. 211-218. by Albert E. Cerussi, Andrew J. Berger, Frederic Bevilacqua, et al.Natasha Shah, Dorota Jakubowski, John Butler, Randall F. Holcombe, Bruce J. Tromberg posted to bibtex-import drbbibtex-import mu_a mu_s optical properties by durduran on 2008-04-08 22:43:41 as
	Compression-induced changes in the physiological state of the breast as observed through frequency domain photon migration measurements [My Copy] Journal of Biomedical Optics, Vol. 11 (2006) by S. A. Carp, T. Kauffman, Q. Fang, et al.E. Rafferty, R. Moore, D. Kopans, D. Boas posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Generalized optical theorem for reflection,transmission, and extinction of scalar fields [My Copy] Physical Review, E (2004) by Scott P. Carney, John C. Schotland, Emil Wolf posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Fast CW imager for ICG and Gd kinetics [My Copy] In Proc. SPIE Vol. 6081, 60810R (Feb. 13, 2006), Vol. 6081, No. 60810R. (2006) by David, Zhongyao Zhao, Shoko Nioka, et al.Arjun G. Yodh, Mitchell Schnall, Britton Chance, Xavier Intes edited by Dimitris posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Comparison of imaged ICG and Gd kinetics with a DOT-MRI instrument. [My Copy] In Biomedical Optics 2006 Technical Digest, No. ME11. (2006) by David Busch, Xavier Intes, Shoko Nioka, Britton Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Multiple wavelength time-of-flight sensor based on time-correlated single-photon counting [My Copy] Review of Scientific Instruments, Vol. 76 (2005) by G. S. Buller, R. D. Harkins, A. Mccarthy, et al.P. A. Hiskett, G. R. Mackinnon, G. R. Smith, R. Sung, A. M. Wallace, R. A. Lamb, K. D. Ridley, Others posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Concurrent Time-Resolved Near-Infrared Spectroscopy and fMRI Measurements of Visually Stimulated Humans [My Copy] (2005) by R. Brühl, A. Kummrow, M. Möller, et al.H. Wabnitz, A. Liebert, B. Ittermann, F. Seifert, H. Rinneberg posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as along with 1 person ajelz
	Spatio-temporal imaging of the hemoglobin in the compressed breast with diffuse optical tomography [My Copy] Physics in Medicine and Biology, Vol. 52, No. 12. (2007), pp. 3619-3641. by G. Boverman, Q. Fang, S. A. Carp, et al.E. L. Miller, D. H. Brooks, J. Selb, R. H. Moore, D. B. Kopans, D. A. Boas posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Spatially varying dynamical properties of turbid media probed with diffusing temporal light correlation [My Copy] J. Opt. Soc. Am. A, Vol. 14, No. 1. (1997), pp. 192-215. by D. A. Boas, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Scattering and Wavelength Transduction of Diffuse Photon Density Waves [My Copy] Phys. Rev. E, Vol. 47, No. 5. (1993), pp. R2999-R3002. by D. A. Boas, M. A. Oleary, B. Chance, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Scattering of Diffuse Photon Density Waves by Spherical Inhomogeneities within Turbid Media - Analytic Solution and Applications [My Copy] Proc. Natl. Acad. Sci. USA, Vol. 91, No. 11. (1994), pp. 4887-4891. by D. A. Boas, M. A. Oleary, B. Chance, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Detection and characterization of optical inhomogeneities with diffuse photon density waves: A signal-to-noise analysis [My Copy] Applied Optics, Vol. 36, No. 1. (1997), pp. 75-92. by D. A. Boas, M. A. Oleary, B. Chance, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:41 as
	Scattering and Imaging with Diffusing Temporal Field Correlations [My Copy] Physical Review Letters, Vol. 75, No. 9. (1995), pp. 1855-1858. by D. A. Boas, L. E. Campbell, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:40 as
	Classification of breast tissue density by optical transillumination spectroscopy: optical and physiological effects governing predictive value. [My Copy] Med Phys, Vol. 31, No. 6. (Jun 2004), pp. 1398-1414. by Kristina Blyschak, Michelle Simick, Roberta Jong, Lothar Lilge posted to adult aged analysis bibtex-import biophysics body breast component drbbibtex-import factors female humans index mass middle neoplasms optics principal risk transillumination by durduran on 2008-04-08 22:43:40 as
	Assessing breast tissue density by transillumination breast spectroscopy (TIBS): an intermediate indicator of cancer risk. [My Copy] Br J Radiol, Vol. 80, No. 955. (Jul 2007), pp. 545-556. by K. M. Blackmore, J. A. Knight, R. Jong, L. Lilge posted to adult aged analysis area assessment bibtex-import breast component curve drbbibtex-import female humans logistic middle models near-infrared neoplasms principal risk spectroscopy transillumination under by durduran on 2008-04-08 22:43:40 as
	Ten years experience with choroidal angiography using indocyanine green dye: a new routine examination or an epilogue? [My Copy] Doc Ophthalmol, Vol. 60, No. 3. (Sep 1985), pp. 235-291. by P. M. Bischoff, R. W. Flower posted to aged angiography artery bibtex-import blood choroid degeneration diabetic diseases drbbibtex-import flow fluorescein green hemangioma hemorrhage humans indocyanine macular melanoma neoplasms neovascularization nevus pathologic pigmented pigmentosa retinal retinitis retinopathy uveal vein velocity by durduran on 2008-04-08 22:43:40 as
	Penetration depth of light re-emitted by a diffusive medium: theoretical and experimental investigation. [My Copy] Phys Med Biol, Vol. 47, No. 23. (Dec 2002), pp. 4131-4144. by Samuele Del Bianco, Fabrizio Martelli, Giovanni Zaccanti posted to absorption bibtex-import biophysics brain diffusion drbbibtex-import factors light models muscles photons statistical time by durduran on 2008-04-08 22:43:39 as
	Penetration depth of light re-emitted by a diffusive medium: theoretical and experimental investigation. [My Copy] Phys Med Biol, Vol. 47, No. 23. (Dec 2002), pp. 4131-4144. by Samuele Del Bianco, Fabrizio Martelli, Giovanni Zaccanti posted to absorption bibtex-import biophysics brain diffusion drbbibtex-import factors light models muscles photons statistical time by durduran on 2008-04-08 22:43:39 as
	The Effects of Normal as Compared with Low Hematocrit Values in Patients with Cardiac Disease Who Are Receiving Hemodialysis and Epoetin [My Copy] (1998) by A. Besarab, W. K. Bolton, J. K. Browne, et al.J. C. Egrie, A. R. Nissenson, D. M. Okamoto, S. J. Schwab, D. A. Goodkin posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	Correlation properties of multiple scattered light: implication to coherent diagnostics of burned skin [My Copy] Journal of Biomedical Optics, Vol. 9 (2004), pp. 347-352. by A. Bednov, S. Ulyanov, C. Cheung, A. G. Yodh posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	Indocyanine green hyperfluorescence associated with serous retinal pigment epithelial detachment in age-related macular degeneration. [My Copy] Ophthalmology, Vol. 104, No. 5. (May 1997), pp. 761-769. by C. R. Baumal, E. Reichel, J. S. Duker, J. Wong, C. A. Puliafito posted to 80 acuity aged agents and angiography bibtex-import coagulation coloring degeneration detachment drbbibtex-import epithelium eye female fluorescein follow-up fundus green humans indocyanine laser macular male middle oculi of outcome over pigment retinal retrospective studies treatment visual by durduran on 2008-04-08 22:43:39 as
	Objective assessment of image quality. II. Fisher information, Fourier crosstalk, and figures of merit for task performance [My Copy] Journal of the Optical Society of America, A (1995) by Jarrison H. Barrett, J. L. Denny, Robert F. Wagner, Kyle J. Myers posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	Objective assessment of image quality. III. ROC metrics, ideal observers, and likelihood-generating functions [My Copy] Journal of the Optical Society of America, A (1998) by Harrison H. Barrett, Craig K. Abbey, Eric Clarkson posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	Objective assessment of image quality: effects of quantum noise and object variabilty [My Copy] Journal of the Optical Society of America, A, Vol. 7, No. 7. (July 1990), pp. 1266-1278. by Harrison H. Barrett posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	A fast numerical method for time-resolved photon diffusion in general stratified turbid media [My Copy] Journal of Computational Physics, Vol. 201, No. 2. (2004), pp. 771-797. by A. H. Barnett posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:39 as
	Functional imaging of the vascular bed by dynamic optical tomography [My Copy] Proceedings of SPIE, Vol. 5369 (2004), pp. 132-149. by R. L. Barbour, H. L. Graber, Y. Pei, et al.C. H. Schmitz, Y. Xu, A. di Martino, F. X. Castellanos, D. P. Klemer, R. E. Hardin, N. A. Franco, Others posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Statistical Inference, Occam's Razor and Statistical Mechanics on The Space of Probability Distributions [My Copy] arXiv.org (2001) by Vijay Balasubramanian posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	M.D.L., Bayesian Inference and the Geometry of the Space of Probability Distributions [My Copy] To Be Published, MIT Press (2003) by Vijay Balasubramanian posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Cerebral Blood Flow Determination by Rapid-Sequence Computed Tomography, a theoretical analysis [My Copy] Radiology (1980) by Leon Axel posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	A Finite Element Approach for Modeling Photon Transport in Tissue [My Copy] Med. Phys., Vol. 20, No. 2. (1993) by S. R. Arridge, M. Schweiger, M. Hiraoka, D. T. Delpy posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	A gradient-based optimisation scheme for optical tomography [My Copy] Opt. Express, Vol. 2 (1998) by S. R. Arridge, M. Schweiger posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Statistical basis for the determination of optical pathlength in tissue. [My Copy] Phys Med Biol, Vol. 40, No. 9. (Sep 1995), pp. 1539-1558. by S. R. Arridge, M. Hiraoka, M. Schweiger posted to 8532764 animals bibtex-import carlo confidence drbbibtex-import humans infrared intervals light mathematics method models monte of processes reproducibility results spectrophotometry statistical stochastic by durduran on 2008-04-08 22:43:38 as
	The theoretical basis for the determination of optical pathlengths in tissue: temporal and frequency analysis. [My Copy] Phys Med Biol, Vol. 37, No. 7. (Jul 1992), pp. 1531-1560. by S. R. Arridge, M. Cope, D. T. Delpy posted to 1631197 animals bibtex-import carlo confidence diagnostic diffusion drbbibtex-import humans imaging infrared intervals lasers light mathematics method models monte of processes radiation rays reproducibility results scattering spectrophotometry statistical stochastic theoretical by durduran on 2008-04-08 22:43:38 as
	Optical tomography in medical imaging [My Copy] Inverse Problems, Vol. 15 (1996), pp. R41-R93. by Simon R. Arridge posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	A Finite Element approach to modelling photon transport in tissue [My Copy] Medical Physics, Vol. 20, No. 2. (1993), pp. 299-309. by S. R. Arridge, M. Schweiger, M. Hiraoka, D. T. Delpy posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Determination of the Optical Properties of Two-Layer Turbid Media by Use of a Frequency-Domain Hybrid Monte Carlo Diffusion Model [My Copy] Appl. Opt, Vol. 40 (2001), pp. 3810-3821. by G. Alexandrakis, D. R. Busch, G. W. Faris, M. S. Patterson posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Evaluation of Multimodality Breast Imaging: Project 3- Lesion Staging [My Copy] No. 414500. (October 2003) by Abass Alavi, Susan Orel posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:38 as
	Analysis of ICG Pharmacokinetics in Cancerous Tumors using NIR Optical Methods. [My Copy] Conf Proc IEEE Eng Med Biol Soc, Vol. 1 (2005), pp. 62-65. by Burak Alacam, Birsen Yazici, Xavier Intes, Britton Chance posted to bibtex-import drbbibtex-import by durduran on 2008-04-08 22:43:37 as
	Extended kalman filtering for the modeling and analysis of ICG pharmacokinetics in cancerous tumors using NIR optical methods. [My Copy] IEEE Trans Biomed Eng, Vol. 53, No. 10. (Oct 2006), pp. 1861-1871. by Burak Alacam, Birsen Yazici, Xavier Intes, Britton Chance posted to adenocarcinoma algorithms animals bibtex-import biological cell clearance computer computer-assisted diagnosis drbbibtex-import f344 green inbred indocyanine infrared line metabolic models rate rats simulation spectrophotometry tumor by durduran on 2008-04-08 22:43:37 as
	Breast tissue characterization using FARMA modeling of ultrasonic RF echo. [My Copy] Ultrasound Med Biol, Vol. 30, No. 10. (Oct 2004), pp. 1397-1407. by Burak Alacam, Birsen Yazici, Nihat Bilgutay, Flemming Forsberg, Catherine Piccoli posted to adolescent adult age aged and bibtex-import breast computer-assisted curve drbbibtex-import factors female humans image interpretation mammary mammography middle models neoplasms of reproducibility results roc sensitivity specificity statistical ultrasonography by durduran on 2008-04-08 22:43:37 as
	$My PDF akorn\ inc._01_icgreentm.pdf$ IC-Green$^TM$ Sterile Indocyanine Green [My Copy] (Version: 6-DCGN-01) by Akorn\ Inc. posted to bibtex-import drbbibtex-import icg by durduran on 2008-04-08 22:43:37 as
	Indocyanine green angiographic features of traumatic choroidal ruptures. [My Copy] Eye, Vol. 12 ( Pt 4) (1998), pp. 646-650. by A. Akman, S. Kadayifçilar, S. Oto, P. Aydin posted to adult agents angiography bibtex-import blood choroid coloring drbbibtex-import flow fluorescein fundus green healing humans indocyanine male oculi regional rupture wound by durduran on 2008-04-08 22:43:36 as

Note: You may cite this page as: http://www.citeulike.org/user/durduran/tag/bibtex-import

Result page: 1 2 Next

eylembibtex	1110
nirs	61
bibtex-import	51
drbbibtex-import	50
cbf	39
stroke	30
near-infrared	20
dcs	18
ischemia	16
chd	15
congenitalheartdefect	15
durduran	14
ischemicstroke	14
neonate	14
news_tdresearch	14
strokepublicity	14
upenn	14
hypercapnia	13
neonatal	10
humans	9
review	9
adult	8
dot	8
file-import-08-06-12	8
models	7
statistical	7
trs	7
aged	6
breast	6
icg	6
nearinfrared	6
tcd	6
brain	5
congenitalheart	5
flow	5
functional	5
imaging	5
light	5
middle	5
mri	5
neoplasms	5
timesresolved	5
autoregulation	4
blood	4
cerebralbloodflow	4
cmro2	4
diffuseoptics	4
factors	4
female	4
green	4
indocyanine	4
mammography	4
montecarlo	4
of	4
time-domain-analysis	4
xenonct	4
allages	3
angiography	3
animals	3
biophysics	3
bold	3
bypass	3
carlo	3
cerebral	3
children	3
co2	3
computer-assisted	3
congenital	3
diffuse	3
diffusion	3
fluorescein	3
fluorescence	3
functionalimaging	3
infrared	3
kurth	3
laserdoppler	3
monitoring	3
monte	3
nearinfraredspectroscopy	3
neurology	3
opticalmammography	3
piglet	3
reproducibility	3
results	3
risk	3
spectrophotometry	3
timedomain	3
xenoncbfeffect	3
absorption	2
agents	2
algorithms	2
analysis	2
and	2
artery	2
bloodflow	2
brittonchance	2
choroid	2
classic	2
classicreference	2
cognitive	2
coloring	2
component	2
confidence	2
continuum	2
curve	2
degeneration	2
doppler	2
evokedpotentials	2
file-import-08-12-08	2
fmri	2
frequencydomain	2
fundus	2
image	2
interpretation	2
intervals	2
laser	2
laserspeckle	2
macular	2
male	2
mathematics	2
method	2
modeling	2
molecularimaging	2
motor	2
muscles	2
neonates	2
neovascularization	2
oculi	2
ois	2
okada	2
optics	2
oxygenation	2
pathologic	2
pediatric	2
photons	2
principal	2
processes	2
rat	2
retinal	2
sep	2
speckle	2
statistics	2
stochastic	2
surgery	2
time	2
toexport	2
tomography	2
transillumination	2
transport	2
trauma	2
tumor	2
1631197	1
80	1
8532764	1
acids	1
acuity	1
adenocarcinoma	1
adolescent	1
age	1
akaikacriteria	1
ana	1
area	1
art	1
asl	1
assessment	1
baby	1
biological	1
bioluminescence	1
blandlatman	1
boas	1
body	1
brainfunction	1
broadband	1
brownianmotion	1
caffeine	1
cancer	1
carbondioxide	1
cardiopulmanory	1
cardiopulmonary	1
cariopulmorybypass	1
carotid	1
carotidocclusivedisease	1
cbv	1
cell	1
chance	1
chancewilson	1
charite	1
circulation	1
classification	1
clearance	1
clinicalmeasurement	1
coagulation	1
computer	1
contrast	1
correlation	1
correlationfunctions	1
correlator	1
cubeddu	1
cultureconflict	1
culver	1
cyanine	1
depthpenetration	1
detachment	1
detection	1
development	1
diabetic	1
diagnosis	1
diagnostic	1
diffusecorrelation	1
diffuseiontheory	1
diffusive	1
disease	1
diseases	1
dopplerultrasound	1
dws	1
electrophysiology	1
enhancement	1
epilepsy	1
epithelium	1
europe	1
european	1
europeanstrokeinitiative	1
europeanunion	1
ey	1
eye	1
f344	1
fast	1
fetal	1
file-import-08-08-21	1
file-import-08-09-02	1
file-import-08-09-30	1
finite-element-analysis	1
finitelements	1
flowmetry	1
fnirs	1
follow-up	1
forepaw	1
franceschini	1
frequency-domain-analysis	1
functionalmapping	1
generalinterest	1
genocide	1
gratton	1
headofbedposition	1
healing	1
hemangioma	1
hemodynamics	1
hemorrhage	1
heterodyne	1
hillman	1
history	1
hlhs	1
hob	1
huabei	1
humanity	1
hypercania	1
hypercapniaclassicalrefreviewgetwholeissue	1
hypoexima	1
hypothermia	1
hypoxia	1
illustion	1
image-reconstruction	1
inbred	1
index	1
indocynaninegreen	1
infant	1
intraoperative	1
invos	1
isoflurane	1
jbo	1
kirkpatrick	1
lamb	1
language	1
lasca	1
lasers	1
ldf	1
liebert	1
lifetime	1
line	1
lme	1
locomotor	1
logistic	1
low-scattering	1
lsf	1
mammary	1
mass	1
media	1
medical-image-processing	1
melanoma	1
meningitis	1
merci	1
metabolic	1
metabolism	1
mouse	1
mousemodel	1
mridot	1
mu_a	1
multilayer	1
mu_s	1
nearinfared	1
neoplasia	1
neuroprotective	1
neurovascularcoupling	1
nevus	1
newborn	1
nih	1
nlme	1
nonwork	1
occlusive	1
occulusion	1
optical	1
opticalintrinsicsignals	1
optical-tomography	1
outcome	1
over	1
pad	1
pco2	1
peace	1
peripheralarterialdisease	1
pet	1
phantoms	1
pharmacologicalintervention	1
phasecancellation	1
photon	1
photonefficiency	1
pigment	1
pigmented	1
pigmentosa	1
pilot	1
pogue	1
primate	1
projects	1
properties	1
pulseoximetry	1
radiation	1
radiographic	1
rate	1
rats	1
rays	1
recanalization	1
recovery	1
regional	1
regulation	1
retinitis	1
retinopathy	1
retrospective	1
roc	1
r-project	1
rtpa	1
rupture	1
scattering	1
seizure	1
sensitivity	1
simulation	1
sliced	1
society	1
sourceterm	1
specificity	1
spect	1
spectroscopy	1
standard	1
statisticsonchd	1
stimulation	1
strangulation	1
strokeguidelines	1
stroketreatment	1
studies	1
supercontinuum	1
supportvector	1
tbi	1
theoretical	1
theory	1
thresholds	1
time-domain	1
time-domainanalysis	1
timeresolved	1
trancranialdoppler	1
transcranialdoppler	1
traumaticbraininjury	1
treatment	1
tribal	1
triiodobenzoic	1
turbidmedia	1
tutorial	1
twolayer	1
ultrasonography	1
under	1
uveal	1
vasilis	1
vasoreactivity	1
vein	1
velocity	1
verbalfluency	1
villringer	1
vision	1
visual	1
wabnitz	1
warfare	1
whitelight	1
workshop	1
wound	1

durduran's bibtex-import [51 articles] Export

durduran's tags