durduran's nirs [61 articles] Export

Recent papers added to durduran's library classified by the tag nirs. You can also see everyone's nirs.

	Photonics Against Stroke: Bedside monitoring of brain blood flow in stroke victims [My Copy] ICFO Newsroom-News (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	A Bedside Cap for the Monitoring of Stroke Victims [My Copy] by Office posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Penn Research Team Tests Bedside Monitoring of Brain Blood Flow and Metabolism in Stroke Victims [My Copy] Penn Office of University Communications posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Medical Researchers Test Bedside Monitoring Of Brain Blood Flow And Metabolism In Stroke Victims [My Copy] Science Daily posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Research team tests bedside monitoring of brain blood flow and metabolism in stroke victims [My Copy] Science Blog (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Noninvasive optical device monitors brain blood flow and metabolism in stroke victims [My Copy] News Medical Net posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Penn research team tests bedside monitoring of brain blood flow and metabolism in stroke victims [My Copy] Science News (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Penn research team tests bedside monitoring of brain blood flow and metabolism in stroke victims [My Copy] ScienceMode (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Penn research team tests bedside monitoring of brain blood flow and metabolism in stroke [My Copy] Bio-Medicine (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Research team tests bedside monitoring of brain blood flow and metabolism in stroke victims [My Copy] (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Penn research team tests bedside monitoring of brain blood flow and metabolism in stroke victims [My Copy] NewsGuide (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Post-stroke blood flow monitor developed [My Copy] UPI NewsTrack Health and Science News - UPI.com (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Bedside Monitoring Of Brain Blood Flow And Metabolism In Stroke Victims By Penn Research Team [My Copy] Medical News Today (March 2009) posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	UPI NewsTrack Health and Science News - MarketWatch [My Copy] posted to cbf dcs durduran ischemia ischemicstroke news_tdresearch nirs stroke strokepublicity upenn by durduran on 2009-03-17 09:15:09 as
	Brain cell function during hypoxemia in near-term lambs: a near-infrared spectroscopy study. [My Copy] Biology of the neonate, Vol. 88, No. 2. (2005), pp. 79-86. by S. Van Os, J. Klaessens, J. Hopman, D. Liem, M. Van de Bor posted to cmro2 hypercapnia hypoexima lamb nirs by durduran on 2008-12-08 23:03:19 as
	Transcranial Doppler and Near-Infrared Spectroscopy Can Evaluate the Hemodynamic Effect of Carotid Artery Occlusion [My Copy] Stroke, Vol. 35, No. 1. (1 January 2004), pp. 64-70. by Fabrizio Vernieri, Francesco Tibuzzi, Patrizio Pasqualetti, et al.Nicola Rosato, Francesco Passarelli, Paolo M. Rossini, Mauro Silvestrini posted to artery cbf dopplerultrasound hypercapnia nearinfraredspectroscopy nirs occulusion stroke tcd transcranialdoppler by durduran on 2008-10-13 17:36:08 as
	Cerebral oxygenation during cardiopulmonary bypass in children, , [My Copy] The Journal of Thoracic and Cardiovascular Surgery, Vol. 113, No. 1. (January 1997), pp. 71-79. by Kurth, James M. Steven, Susan C. Nicolson, Marshall L. Jacobs posted to baby bypass cariopulmorybypass children congenitalheart congenitalheartdefect kurth near-infrared neonate nirs by durduran on 2008-09-12 19:07:26 as
	Near-infrared monitoring of the cerebral circulation [My Copy] Journal of Clinical Monitoring and Computing, Vol. 9, No. 3. (11 October 1992), pp. 163-170. by Dean C. Kurth, J. M. Steven, D. Benaron, B. Chance posted to cerebral chance kurth nearinfrared nirs piglet review by durduran on 2008-09-12 18:59:11 as
	Measurement of cerebral blood flow during cardiopulmonary bypass with near-infrared spectroscopy [My Copy] J Thorac Cardiovasc Surg, Vol. 115, No. 1. (1 January 1998), pp. 94-98. by Idris G. Roberts, Penny Fallon, Fenella J. Kirkham, et al.Paul M. Kirshbom, Christopher E. Cooper, Martin J. Elliott, David A. Edwards posted to cbf chd congenitalheart congenitalheartdefect cyanine icg indocynaninegreen nearinfrared nirs by durduran on 2008-09-12 18:45:40 as along with 1 person ajelz
	Cerebral hemodynamics during cardiopulmonary bypass in children using near-infrared spectroscopy [My Copy] Ann Thorac Surg, Vol. 56, No. 6. (1 July 1993), pp. 1473-1477. by P. Fallon, I. Roberts, F. J. Kirkham, et al.M. J. Elliott, A. Lloyd-Thomas, R. Maynard, A. D. Edwards posted to chd congenital congenitalheart congenitalheartdefect nirs by durduran on 2008-09-12 18:42:07 as
	Cerebral oxygen saturation before congenital heart surgery [My Copy] The Annals of Thoracic Surgery, Vol. 72, No. 1. (July 2001), pp. 187-192. by Dean C. Kurth, James L. Steven, Lisa M. Montenegro, et al.Marc H. Watzman, William J. Gaynor, Thomas L. Spray, Susan C. Nicolson posted to cerebral chd congenital congenitalheart congenitalheartdefect kurth nirs oxygenation by durduran on 2008-09-12 18:34:14 as
	Current Trends in Intraoperative Optical Imaging for Functional Brain Mapping and Delineation of Lesions of Language Cortex [My Copy] NeuroImage, Vol. In Press, Accepted Manuscript by Neal Prakash, Falk Uhleman, Sameer A. Sheth, Susan Bookheimer, Neil Martin, Arthur W. Toga posted to functionalimaging functionalmapping intraoperative nirs ois opticalintrinsicsignals by durduran on 2008-09-05 19:45:21 as
	Tutorial on diffuse light transport [My Copy] Journal of Biomedical Optics, Vol. 13, No. 4. (2008) by Steven L. Jacques, Brian W. Pogue posted to diffuse diffuseoptics light nirs transport tutorial by durduran on 2008-09-04 18:46:26 as along with 2 people ajelz drbusch
	The influence of positioning upon cerebral oxygenation after acute stroke: a pilot study [My Copy] Age Ageing, Vol. 37, No. 5. (1 September 2008), pp. 581-585. by David Hargroves, Raymond Tallis, Valerie Pomeroy, Ajay Bhalla posted to headofbedposition hob nirs stroke by durduran on 2008-08-29 14:59:01 as along with 1 person meeri
	Effective source term in the diffusion equation for photon transport in turbid media [My Copy] Appl. Opt., Vol. 36, No. 1. (1 January 1997), pp. 156-163. by Sergio Fantini, Maria A. Franceschini, Enrico Gratton posted to diffuse diffuseoptics dot nirs photon sourceterm transport turbidmedia by durduran on 2008-08-28 15:08:14 as along with 1 person ebuckle2
	Least-squares support vector machines modelization for time-resolved spectroscopy [My Copy] Appl. Opt., Vol. 44, No. 33. (20 November 2005), pp. 7091-7097. by Fabien Chauchard, Sylvie Roussel, Jean-Michel Roger, et al.Véronique Bellon-Maurel, Christoffer Abrahamsson, Tomas Svensson, Stefan Andersson-Engels, Sune Svanberg posted to nirs supportvector timedomain time-domain-analysis timesresolved trs by durduran on 2008-08-27 23:40:52 as along with 1 person drbusch
	Time and wavelength resolved spectroscopy of turbid media using light continuum generated in a crystal fiber [My Copy] Opt. Express, Vol. 12, No. 17. (2004), pp. 4103-4112. by Christoffer Abrahamsson, Tomas Svensson, Sune Svanberg, Stefan Andersson-Engels, Jonas Johansson, Staffan Folestad posted to continuum nirs time-domain-analysis timesresolved trs by durduran on 2008-08-27 23:40:16 as along with 1 person drbusch
	Monte Carlo algorithm for efficient simulation of time-resolved fluorescence in layered turbid media [My Copy] Opt. Express, Vol. 16, No. 17. (2008), pp. 13188-13202. by A. Liebert, H. Wabnitz, N. Zolek, R. Macdonald posted to carlo fluorescence monte montecarlo nirs timedomain time-domain-analysis timesresolved trs by durduran on 2008-08-26 00:04:36 as along with 1 person ajelz
	Photonic textiles for pulse oximetry [My Copy] Opt. Express, Vol. 16, No. 17. (2008), pp. 12973-12986. by Markus Rothmaier, Bärbel Selm, Sonja Spichtig, Daniel Haensse, Martin Wolf posted to nirs pulseoximetry by durduran on 2008-08-26 00:00:44 as
	Time resolved reflectance and transmittance for the noninvasive measurement of tissue optical properties [My Copy] Appl. Opt., Vol. 28, No. 12. (15 June 1989), 2331. by Michael S. Patterson, B. Chance, B. C. Wilson posted to brittonchance chancewilson classic nearinfrared nirs timesresolved trs by durduran on 2008-08-25 18:44:21 as along with 3 people kdouglass physicist ebuckle2
	MRI-guided diffuse optical spectroscopy of malignant and benign breast lesions. [My Copy] Neoplasia (New York, N.Y.), Vol. 4, No. 4. (g 2002), pp. 347-354. by V. Ntziachristos, A. G. Yodh, M. D. Schnall, B. Chance posted to dot mri mridot neoplasia nirs opticalmammography vasilis by durduran on 2008-08-25 18:43:39 as along with 2 people YvesDeDeene ebuckle2
	A novel method for fast imaging of brainfunction, non-invasively, with light [My Copy] Opt. Express, Vol. 2, No. 10. (11 May 1998), pp. 411-423. by Britton Chance, Endla Anday, Shoko Nioka, et al.Shuoming Zhou, Long Hong, Katherine Worden, C. Li, T. Murray, Y. Ovetsky, D. Pidikiti, R. Thomas posted to brainfunction brittonchance nearinfared nirs phasecancellation by durduran on 2008-08-25 18:43:15 as along with 1 person ebuckle2
	Monte Carlo Prediction of Near-Infrared Light Propagation in Realistic Adult and Neonatal Head Models [My Copy] Appl. Opt., Vol. 42, No. 16. (1 June 2003), pp. 2881-2887. by Yuich Fukui, Yusaku Ajichi, Eiji Okada posted to adult modeling montecarlo neonate nirs okada by durduran on 2008-08-25 18:42:39 as along with 1 person ebuckle2
	Practical and adequate approach to modeling light propagation in an adult head with low-scattering regions by use of diffusion theory [My Copy] Appl. Opt., Vol. 44, No. 11. (10 April 2005), pp. 2094-2103. by Tatsuya Koyama, Atsushi Iwasaki, Yosuke Ogoshi, Eiji Okada posted to low-scattering modeling montecarlo nirs okada by durduran on 2008-08-25 18:42:13 as along with 1 person ebuckle2
	Monitoring of Cerebral Oxygenation during Hypoxic Gas Management in Congenital Heart Disease with Increased Pulmonary Blood Flow. [My Copy] Pediatric Research, Vol. 58, No. 3. (2005) by T. Takami, H. Yamamura, I. N. A. I. Kei, et al.Y. Nishikawa, Y. Takei, A. Hoshika, M. Nakazawa posted to chd congenitalheart nirs by durduran on 2008-08-21 21:22:40 as
	Fast time-domain diffuse optical tomography using pseudorandom bit sequences [My Copy] Opt. Express, Vol. 16, No. 18. (2008), pp. 13643-13650. by Weirong Mo, Nanguang Chen posted to dot fast nearinfrared nearinfraredspectroscopy nirs timedomain trs by durduran on 2008-08-21 21:15:42 as
	Optical imaging of infants' neurocognitive development: Recent advances and perspectives [My Copy] Developmental Neurobiology, Vol. 68, No. 6. (2008), pp. 712-728. by Yasuyo Minagawa-Kawai, Koichi Mori, Jeremy C. Hebden, Emmanuel Dupoux posted to cognitive development dot nearinfraredspectroscopy neonate nirs review by durduran on 2008-08-21 21:10:25 as
	Comparison between a time-domain and a frequency-domain system for optical tomography [My Copy] Journal of Biomedical Optics, Vol. 11, No. 6. (2006) by Ilkka Nissila, Jeremy C. Hebden, David Jennions, et al.Jenni Heino, Martin Schweiger, Kalle Kotilahti, Tommi Noponen, Adam Gibson, Seppo Jarvenpaa, Lauri Lipiainen, Toivo Katila posted to dot finite-element-analysis frequencydomain frequency-domain-analysis image-reconstruction medical-image-processing nirs optical-tomography phantoms time-domain-analysis trs by durduran on 2008-08-21 21:07:55 as
	Feasibility of white-light time-resolved optical mammography [My Copy] Journal of Biomedical Optics, Vol. 11, No. 5. (2006) by Andrea Bassi, Lorenzo Spinelli, Cosimo D'Andrea, et al.Arianna Giusto, Johannes Swartling, Antonio Pifferi, Alessandro Torricelli, Rinaldo Cubeddu posted to breast cancer continuum cubeddu dot mammography nirs opticalmammography supercontinuum whitelight by durduran on 2008-08-19 20:45:00 as along with 1 person drbusch
	Spectral tomography with diffuse near-infrared light: inclusion of broadband frequency domain spectral data [My Copy] Journal of Biomedical Optics, Vol. 13, No. 4. (2008) by Jia Wang, Scott C. Davis, Subhadra Srinivasan, Shudong Jiang, Brian W. Pogue, Keith D. Paulsen posted to broadband diffuse diffuseoptics dot frequencydomain nirs pogue by durduran on 2008-08-18 17:22:25 as along with 1 person and 1 group pick600 Computerized Tomography
	Molecular imaging with optics: primer and case for near-infrared fluorescence techniques in personalized medicine [My Copy] Journal of Biomedical Optics, Vol. 13, No. 4. (2008) by Eva, John C. Rasmussen posted to fluorescence jbo molecularimaging nirs by durduran on 2008-08-01 21:37:34 as along with 1 person drbusch
	Functional near-infrared spectroscopy: A long-term reliable tool for measuring brain activity during verbal fluency [My Copy] NeuroImage, Vol. In Press, Accepted Manuscript by Martin Schecklmann, Ann-Christine Ehlis, Michael M. Plichta, Andreas J. Fallgatter posted to cognitive functional nirs verbalfluency by durduran on 2008-07-25 00:01:28 as
	Impact of Inspired Gas Mixtures on Preoperative Infants With Hypoplastic Left Heart Syndrome During Controlled Ventilation [My Copy] Circulation, Vol. 104, No. 90001. (2001), pp. I159-I164. by Sarah Tabbutt, Chandra Ramamoorthy, Lisa M. Montenegro, et al.Suzanne M. Durning, Dean C. Kurth, James M. Steven, Rodolfo I. Godinez, Thomas L. Spray, Gil Wernovsky, Susan C. Nicolson posted to chd congenitalheartdefect hlhs hypercapnia infant nearinfrared near-infrared neonatal neonate nirs by durduran on 2008-07-21 19:50:05 as
	Continuous time-domain analysis of cerebrovascular autoregulation using near-infrared spectroscopy. [My Copy] Stroke; a journal of cerebral circulation, Vol. 38, No. 10. (1 October 2007), pp. 2818-2825. by K. M. Brady, J. K. Lee, K. K. Kibler, et al.P. Smielewski, M. Czosnyka, R. B. Easley, R. C. Koehler, D. H. Shaffner posted to autoregulation cbf invos laserdoppler nearinfrared nirs piglet regulation by durduran on 2008-04-24 18:04:40 as along with 1 person meeri
	Optical brain imaging in vivo: techniques and applications from animal to man [My Copy] Journal of Biomedical Optics, Vol. 12, No. 5. (2007) by Elizabeth M. C. Hillman posted to brain dcs hillman near-infrared nirs review by durduran on 2008-04-11 22:26:12 as along with 1 person meeri
	Tissue oxygen index: thresholds for cerebral ischemia using near-infrared spectroscopy. [My Copy] Stroke; a journal of cerebral circulation, Vol. 37, No. 11. (1 November 2006), pp. 2720-2725. by Pippa G. Al-Rawi, Peter J. Kirkpatrick posted to cbf ischemia kirkpatrick near-infrared nirs surgery thresholds by durduran on 2008-04-11 21:55:16 as along with 1 person alanvelander
	Bed-side assessment of cerebral perfusion in stroke patients based on optical monitoring of a dye bolus by time-resolved diffuse reflectance [My Copy] NeuroImage, Vol. 24, No. 2. (15 January 2005), pp. 426-435. by A. Liebert, H. Wabnitz, J. Steinbrink, et al.M. Moller, R. Macdonald, H. Rinneberg, A. Villringer, H. Obrig posted to cbf charite icg liebert near-infrared nirs stroke wabnitz by durduran on 2008-04-11 21:52:22 as along with 1 person ajelz
	Language-Activated Cerebral Blood Oxygenation and Hemodynamic Changes of the Left Prefrontal Cortex in Poststroke Aphasic Patients : A Near-Infrared Spectroscopy Study [My Copy] Stroke, Vol. 29, No. 7. (1 July 1998), pp. 1299-1304. by Kaoru Sakatani, Yuxiao Xie, Wemara Lichty, Sunwei Li, Huancong Zuo posted to cbf functional language near-infrared nirs stroke by durduran on 2008-04-11 18:55:56 as
	Temporal and Anatomic Risk Profile of Brain Injury With Neonatal Repair of Congenital Heart Defects [My Copy] Stroke, Vol. 38, No. 2. (1 February 2007), pp. 736-741. by Patrick S. Mcquillen, James A. Barkovich, Shannon E. Hamrick, et al.Marta Perez, Phil Ward, David V. Glidden, Anthony Azakie, Tom Karl, Steven P. Miller posted to chd congenitalheartdefect mri near-infrared neonate nirs pediatric by durduran on 2008-04-09 21:24:04 as
	Near infrared spectroscopy (NIRS) distinguishes seizure types [My Copy] Seizure, Vol. 9, No. 5. (July 2000), pp. 323-327. by D. K. Sokol, O. N. Markand, E. C. Daly, T. G. Luerssen, M. D. Malkoff posted to epilepsy near-infrared nirs seizure by durduran on 2008-04-09 21:15:15 as

Note: You may cite this page as: http://www.citeulike.org/user/durduran/tag/nirs

Result page: 1 2 Next

eylembibtex	1110
nirs	61
bibtex-import	51
drbbibtex-import	50
cbf	39
stroke	30
near-infrared	20
dcs	18
ischemia	16
chd	15
congenitalheartdefect	15
durduran	14
ischemicstroke	14
neonate	14
news_tdresearch	14
strokepublicity	14
upenn	14
hypercapnia	13
neonatal	10
humans	9
review	9
adult	8
dot	8
file-import-08-06-12	8
models	7
statistical	7
trs	7
aged	6
breast	6
icg	6
nearinfrared	6
tcd	6
brain	5
congenitalheart	5
flow	5
functional	5
imaging	5
light	5
middle	5
mri	5
neoplasms	5
timesresolved	5
autoregulation	4
blood	4
cerebralbloodflow	4
cmro2	4
diffuseoptics	4
factors	4
female	4
green	4
indocyanine	4
mammography	4
montecarlo	4
of	4
time-domain-analysis	4
xenonct	4
allages	3
angiography	3
animals	3
biophysics	3
bold	3
bypass	3
carlo	3
cerebral	3
children	3
co2	3
computer-assisted	3
congenital	3
diffuse	3
diffusion	3
fluorescein	3
fluorescence	3
functionalimaging	3
infrared	3
kurth	3
laserdoppler	3
monitoring	3
monte	3
nearinfraredspectroscopy	3
neurology	3
opticalmammography	3
piglet	3
reproducibility	3
results	3
risk	3
spectrophotometry	3
timedomain	3
xenoncbfeffect	3
absorption	2
agents	2
algorithms	2
analysis	2
and	2
artery	2
bloodflow	2
brittonchance	2
choroid	2
classic	2
classicreference	2
cognitive	2
coloring	2
component	2
confidence	2
continuum	2
curve	2
degeneration	2
doppler	2
evokedpotentials	2
file-import-08-12-08	2
fmri	2
frequencydomain	2
fundus	2
image	2
interpretation	2
intervals	2
laser	2
laserspeckle	2
macular	2
male	2
mathematics	2
method	2
modeling	2
molecularimaging	2
motor	2
muscles	2
neonates	2
neovascularization	2
oculi	2
ois	2
okada	2
optics	2
oxygenation	2
pathologic	2
pediatric	2
photons	2
principal	2
processes	2
rat	2
retinal	2
sep	2
speckle	2
statistics	2
stochastic	2
surgery	2
time	2
toexport	2
tomography	2
transillumination	2
transport	2
trauma	2
tumor	2
1631197	1
80	1
8532764	1
acids	1
acuity	1
adenocarcinoma	1
adolescent	1
age	1
akaikacriteria	1
ana	1
area	1
art	1
asl	1
assessment	1
baby	1
biological	1
bioluminescence	1
blandlatman	1
boas	1
body	1
brainfunction	1
broadband	1
brownianmotion	1
caffeine	1
cancer	1
carbondioxide	1
cardiopulmanory	1
cardiopulmonary	1
cariopulmorybypass	1
carotid	1
carotidocclusivedisease	1
cbv	1
cell	1
chance	1
chancewilson	1
charite	1
circulation	1
classification	1
clearance	1
clinicalmeasurement	1
coagulation	1
computer	1
contrast	1
correlation	1
correlationfunctions	1
correlator	1
cubeddu	1
cultureconflict	1
culver	1
cyanine	1
depthpenetration	1
detachment	1
detection	1
development	1
diabetic	1
diagnosis	1
diagnostic	1
diffusecorrelation	1
diffuseiontheory	1
diffusive	1
disease	1
diseases	1
dopplerultrasound	1
dws	1
electrophysiology	1
enhancement	1
epilepsy	1
epithelium	1
europe	1
european	1
europeanstrokeinitiative	1
europeanunion	1
ey	1
eye	1
f344	1
fast	1
fetal	1
file-import-08-08-21	1
file-import-08-09-02	1
file-import-08-09-30	1
finite-element-analysis	1
finitelements	1
flowmetry	1
fnirs	1
follow-up	1
forepaw	1
franceschini	1
frequency-domain-analysis	1
functionalmapping	1
generalinterest	1
genocide	1
gratton	1
headofbedposition	1
healing	1
hemangioma	1
hemodynamics	1
hemorrhage	1
heterodyne	1
hillman	1
history	1
hlhs	1
hob	1
huabei	1
humanity	1
hypercania	1
hypercapniaclassicalrefreviewgetwholeissue	1
hypoexima	1
hypothermia	1
hypoxia	1
illustion	1
image-reconstruction	1
inbred	1
index	1
indocynaninegreen	1
infant	1
intraoperative	1
invos	1
isoflurane	1
jbo	1
kirkpatrick	1
lamb	1
language	1
lasca	1
lasers	1
ldf	1
liebert	1
lifetime	1
line	1
lme	1
locomotor	1
logistic	1
low-scattering	1
lsf	1
mammary	1
mass	1
media	1
medical-image-processing	1
melanoma	1
meningitis	1
merci	1
metabolic	1
metabolism	1
mouse	1
mousemodel	1
mridot	1
mu_a	1
multilayer	1
mu_s	1
nearinfared	1
neoplasia	1
neuroprotective	1
neurovascularcoupling	1
nevus	1
newborn	1
nih	1
nlme	1
nonwork	1
occlusive	1
occulusion	1
optical	1
opticalintrinsicsignals	1
optical-tomography	1
outcome	1
over	1
pad	1
pco2	1
peace	1
peripheralarterialdisease	1
pet	1
phantoms	1
pharmacologicalintervention	1
phasecancellation	1
photon	1
photonefficiency	1
pigment	1
pigmented	1
pigmentosa	1
pilot	1
pogue	1
primate	1
projects	1
properties	1
pulseoximetry	1
radiation	1
radiographic	1
rate	1
rats	1
rays	1
recanalization	1
recovery	1
regional	1
regulation	1
retinitis	1
retinopathy	1
retrospective	1
roc	1
r-project	1
rtpa	1
rupture	1
scattering	1
seizure	1
sensitivity	1
simulation	1
sliced	1
society	1
sourceterm	1
specificity	1
spect	1
spectroscopy	1
standard	1
statisticsonchd	1
stimulation	1
strangulation	1
strokeguidelines	1
stroketreatment	1
studies	1
supercontinuum	1
supportvector	1
tbi	1
theoretical	1
theory	1
thresholds	1
time-domain	1
time-domainanalysis	1
timeresolved	1
trancranialdoppler	1
transcranialdoppler	1
traumaticbraininjury	1
treatment	1
tribal	1
triiodobenzoic	1
turbidmedia	1
tutorial	1
twolayer	1
ultrasonography	1
under	1
uveal	1
vasilis	1
vasoreactivity	1
vein	1
velocity	1
verbalfluency	1
villringer	1
vision	1
visual	1
wabnitz	1
warfare	1
whitelight	1
workshop	1
wound	1

durduran's nirs [61 articles] Export

durduran's tags