durduran's tags

1631197   80   8532764   absorption   acids   acuity   adenocarcinoma   adolescent   adult   age   aged   agents   akaikacriteria   algorithms   allages   ana   analysis   and   angiography   animals   area   art   artery   asl   assessment   autoregulation   baby   bibtex-import   biological   bioluminescence   biophysics   blandlatman   blood   bloodflow   boas   body   bold   brain   brainfunction   breast   brittonchance   broadband   brownianmotion   bypass   caffeine   cancer   carbondioxide   cardiopulmanory   cardiopulmonary   cariopulmorybypass   carlo   carotid   carotidocclusivedisease   cbf   cbv   cell   cerebral   cerebralbloodflow   chance   chancewilson   charite   chd   children   choroid   circulation   classic   classicreference   classification   clearance   clinicalmeasurement   cmro2   co2   coagulation   cognitive   coloring   component   computer   computer-assisted   confidence   congenital   congenitalheart   congenitalheartdefect   continuum   contrast   correlation   correlationfunctions   correlator   cubeddu   cultureconflict   culver   curve   cyanine   dcs   degeneration   depthpenetration   detachment   detection   development   diabetic   diagnosis   diagnostic   diffuse   diffusecorrelation   diffuseiontheory   diffuseoptics   diffusion   diffusive   disease   diseases   doppler   dopplerultrasound   dot   drbbibtex-import   durduran   dws   electrophysiology   enhancement   epilepsy   epithelium   europe   european   europeanstrokeinitiative   europeanunion   evokedpotentials   ey   eye   eylembibtex   f344   factors   fast   female   fetal   file-import-08-06-12   file-import-08-08-21   file-import-08-09-02   file-import-08-09-30   file-import-08-12-08   finite-element-analysis   finitelements   flow   flowmetry   fluorescein   fluorescence   fmri   fnirs   follow-up   forepaw   franceschini   frequencydomain   frequency-domain-analysis   functional   functionalimaging   functionalmapping   fundus   generalinterest   genocide   gratton   green   headofbedposition   healing   hemangioma   hemodynamics   hemorrhage   heterodyne   hillman   history   hlhs   hob   huabei   humanity   humans   hypercania   hypercapnia   hypercapniaclassicalrefreviewgetwholeissue   hypoexima   hypothermia   hypoxia   icg   illustion   image   image-reconstruction   imaging   inbred   index   indocyanine   indocynaninegreen   infant   infrared   interpretation   intervals   intraoperative   invos   ischemia   ischemicstroke   isoflurane   jbo   kirkpatrick   kurth   lamb   language   lasca   laser   laserdoppler   lasers   laserspeckle   ldf   liebert   lifetime   light   line   lme   locomotor   logistic   low-scattering   lsf   macular   male   mammary   mammography   mass   mathematics   media   medical-image-processing   melanoma   meningitis   merci   metabolic   metabolism   method   middle   modeling   models   molecularimaging   monitoring   monte   montecarlo   motor   mouse   mousemodel   mri   mridot   mu_a   multilayer   mu_s   muscles   nearinfared   nearinfrared   near-infrared   nearinfraredspectroscopy   neonatal   neonate   neonates   neoplasia   neoplasms   neovascularization   neurology   neuroprotective   neurovascularcoupling   nevus   newborn   news_tdresearch   nih   nirs   nlme   nonwork   no-tag   occlusive   occulusion   oculi   of   ois   okada   optical   opticalintrinsicsignals   opticalmammography   optical-tomography   optics   outcome   over   oxygenation   pad   pathologic   pco2   peace   pediatric   peripheralarterialdisease   pet   phantoms   pharmacologicalintervention   phasecancellation   photon   photonefficiency   photons   piglet   pigment   pigmented   pigmentosa   pilot   pogue   primate   principal   processes   projects   properties   pulseoximetry   radiation   radiographic   rat   rate   rats   rays   recanalization   recovery   regional   regulation   reproducibility   results   retinal   retinitis   retinopathy   retrospective   review   risk   roc   r-project   rtpa   rupture   scattering   seizure   sensitivity   sep   simulation   sliced   society   sourceterm   specificity   speckle   spect   spectrophotometry   spectroscopy   standard   statistical   statistics   statisticsonchd   stimulation   stochastic   strangulation   stroke   strokeguidelines   strokepublicity   stroketreatment   studies   supercontinuum   supportvector   surgery   tbi   tcd   theoretical   theory   thresholds   time   timedomain   time-domain   time-domainanalysis   time-domain-analysis   timeresolved   timesresolved   toexport   tomography   trancranialdoppler   transcranialdoppler   transillumination   transport   trauma   traumaticbraininjury   treatment   tribal   triiodobenzoic   trs   tumor   turbidmedia   tutorial   twolayer   ultrasonography   under   upenn   uveal   vasilis   vasoreactivity   vein   velocity   verbalfluency   villringer   vision   visual   wabnitz   warfare   whitelight   workshop   wound   xenoncbfeffect   xenonct